>5dkb_B mol:protein length:257  Estrogen receptor
IKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQG
KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDH
IHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNV
VPLSDLLLEMLDAHRLHAPTS
>5dkb_D mol:protein length:14  Nuclear receptor coactivator 2
KHKILHRLLQDSSS
>5dkb_D mol:protein length:14  Nuclear receptor coactivator 2
KHKILHRLLQDSSS
>5dkb_C mol:protein length:14  Nuclear receptor coactivator 2
KHKILHRLLQDSSS
>5dkb_A mol:protein length:257  Estrogen receptor
IKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQG
KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDH
IHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNV
VPLSDLLLEMLDAHRLHAPTS