>5e1m_D mol:protein length:6  RCC1
PPKRIA
>5e1m_E mol:protein length:6  RCC1
PPKRIA
>5e1m_E mol:protein length:6  RCC1
PPKRIA
>5e1m_A mol:protein length:241  N-terminal Xaa-Pro-Lys N-methyltransferase 1
MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSID
INSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQA
KTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRP
NGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVY
SFALR
>5e1m_B mol:protein length:241  N-terminal Xaa-Pro-Lys N-methyltransferase 1
MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSID
INSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQA
KTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRP
NGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVY
SFALR