>5ek0_A mol:protein length:296  Chimera of bacterial Ion transport protein and human Sodium channel protein type 9 subunit alpha
MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNMVTMMVEKEGQSQHMT
EVLYWINVVFIILFTIEIILRIYVHRISFFKDPWSLFDFVVVIISIVGMFLADLIETYF
VSPTLFRVIRLARIGRILRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMA
TQLFGERFPEWFGTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTF
VMINLVVAIIVDAMAILNQKEEQHIIDEVQSHEDNINNEIIKLREEIVELKELIKTSLK
N