>5eli_A mol:protein length:126  Triggering receptor expressed on myeloid cells 2
TGHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFL
RRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLG
TKHHHHHH