>5ete_A mol:protein length:149  Pry1p
SASSSDSDLSDFASSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHS
GGPYGENLALGYDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKT
CGGAWGDYVICSYDPAGNYEGEYADNVEPLA