>5fd3_A mol:protein length:135  Protein lin-54 homolog
GEFSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKA
CLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGC
KNFEESPERKTLMHLAD