>5ffo_C mol:protein length:363  Transforming growth factor beta-1
GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRD
RVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVP
EPVLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLLAPSDSPEWLSFDVTGVV
RQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMAT
PLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFC
LGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSN
MIVRSCKCS