>5flm_C mol:protein length:275  DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVL
HDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSR
DLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWN
PTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESC
GSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN