>5flm_E mol:protein length:210  DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC1
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDGLDQTLEEFKAQFGGKPSEGRPRRTDLT
VLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSL
VDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGD
PVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ