>5flm_L mol:protein length:58  DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC4
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR