>5fwv_A mol:protein length:406  KREMEN PROTEIN 1
MGILPSPGMPALLSLVSLLSVLLMGCVAETGAPSPGLGPGPECFTANGADYRGTQNWTA
LQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWK
YCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYA
CFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVV
YSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHG
RSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEEGSENLYFQGGSLPQERPAV
NQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGTHHHHHHHHHH