>5gag_I mol:protein length:165  50S ribosomal protein L10
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTL
LRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELI
PASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA