>5gjr_Y mol:protein length:70  26S proteasome complex subunit DSS1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAE
LEKHGYKMETS