>5han_H mol:protein length:481  Ribulose bisphosphate carboxylase
MGSSHHHHHHSSGLVPRGSHMDQSNRYANLNLKESELIAGGRHVLCAYIMKPKAGFGNF
IQTAAHFAAESSTGTNVEVFTTDDFTRGVDALVYEVDEANSLMKIAYPIELFDRNVIDG
RAMIASFLTLTIGNNQGMGDVEYAKMYDFYVPPAYLKLFDGPSTTIKDLWRVLGRPVIN
GGFIVGTIIKPKLGLRPQPFANACYDFWLGGDFIKNDEPQGNQVFAPFKDTVRAVADAM
RRAQDKTGEAKLFSFNITADDHYEMLARGEFILETFADNADHIAFLVDGYVAGPAAVTT
ARRAFPKQYLHYHRAGHGAVTSPQSKRGYTAFVLSKMARLQGASGIHTGTMGFGKMEGE
AADRAIAYMITEDAADGPYFHQEWLGMNPTTPIISGGMNALRMPGFFDNLGHSNLIMTA
GGGAFGHVDGGAAGAKSLRQAEQCWKQGADPVEFAKDHREFARAFESFPQDADKLYPNW
RAKLKPQAA