>5hke_A mol:protein length:333  Bile salt hydrolase
MCTAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVAN
DYPLYFDAINEDGLGMAGLNFPGNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARN
LVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTKSGVHIYDNPIGILTNNPEFNY
QMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSS
KGMTVEEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQI
VAVTLNKDKDGNRLVTYPFERKQIINKLNLERHHHHHH
>5hke_B mol:protein length:333  Bile salt hydrolase
MCTAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVAN
DYPLYFDAINEDGLGMAGLNFPGNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARN
LVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTKSGVHIYDNPIGILTNNPEFNY
QMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSS
KGMTVEEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQI
VAVTLNKDKDGNRLVTYPFERKQIINKLNLERHHHHHH
>5hke_B mol:protein length:333  Bile salt hydrolase
MCTAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVAN
DYPLYFDAINEDGLGMAGLNFPGNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARN
LVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTKSGVHIYDNPIGILTNNPEFNY
QMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSS
KGMTVEEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQI
VAVTLNKDKDGNRLVTYPFERKQIINKLNLERHHHHHH