>5hs6_A mol:protein length:274  17-beta-hydroxysteroid dehydrogenase 14
GHMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAV
FILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLL
GTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPY
GVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASE
ANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSGS