>5i1u_A mol:protein length:335  Germacradien-4-ol synthase
MGSSHHHHHHSSGLVPRGSMSDDTSLELPFTHRRNPHQTEAADRHLEWLQRHRELAAVV
SGSTYTGWDITELASLVYPESSAEDLALAADLMGFYFLFDDQFDSPLGRRPEQVALICE
RLSAIAHGTLTAVTSPSERAFADLWRRITLGMTDRWRARAACNWEYYFACHPAEAAGRT
IGQPPDREGYLTLRRGTAAMESIFDMIERLGHFEVPQHVMHHPLFRQLRQLAADIPSFT
NDVRSFAQESERGDVANLVMIVRRDRCCSTAEACAVVWDEAQRMADRFCDLRDQLPDAC
RSMSLDPAQRLAAERYADGMALWLAGYLHWESHTRRYHHG
>5i1u_B mol:protein length:335  Germacradien-4-ol synthase
MGSSHHHHHHSSGLVPRGSMSDDTSLELPFTHRRNPHQTEAADRHLEWLQRHRELAAVV
SGSTYTGWDITELASLVYPESSAEDLALAADLMGFYFLFDDQFDSPLGRRPEQVALICE
RLSAIAHGTLTAVTSPSERAFADLWRRITLGMTDRWRARAACNWEYYFACHPAEAAGRT
IGQPPDREGYLTLRRGTAAMESIFDMIERLGHFEVPQHVMHHPLFRQLRQLAADIPSFT
NDVRSFAQESERGDVANLVMIVRRDRCCSTAEACAVVWDEAQRMADRFCDLRDQLPDAC
RSMSLDPAQRLAAERYADGMALWLAGYLHWESHTRRYHHG
>5i1u_B mol:protein length:335  Germacradien-4-ol synthase
MGSSHHHHHHSSGLVPRGSMSDDTSLELPFTHRRNPHQTEAADRHLEWLQRHRELAAVV
SGSTYTGWDITELASLVYPESSAEDLALAADLMGFYFLFDDQFDSPLGRRPEQVALICE
RLSAIAHGTLTAVTSPSERAFADLWRRITLGMTDRWRARAACNWEYYFACHPAEAAGRT
IGQPPDREGYLTLRRGTAAMESIFDMIERLGHFEVPQHVMHHPLFRQLRQLAADIPSFT
NDVRSFAQESERGDVANLVMIVRRDRCCSTAEACAVVWDEAQRMADRFCDLRDQLPDAC
RSMSLDPAQRLAAERYADGMALWLAGYLHWESHTRRYHHG