>5i4a_A mol:protein length:642  Argonaute protein
GANAYLNLYKIDIPKKIKRLYFYNPDMEPKLFARNLSRVNNFKFQDSNDLVWIEIPDID
FQITPKNVFQYKVEKEEIIKEEEDKKLFVKTLYKYIKKLFLDNDFYFKKGNNFISNSEV
FSLDSNENVNAHLTYKIKIHNISNEYYLSILPKFTFLSKEPALESAIKSGYLYNIKSGK
SFPYISGLDGILKIDIGNNQIVEVAYPENYLFNFTTRDAEKYGFSKEVHEIYKNKVFEG
FKKIPKTLGFLNKITNLNENYQLKDGYKIFINVIYKFKNGESRYAKDVFKYSFYKNEQP
LKAIFFFSSKKQFFEVQKSLKELFHNKHSVFYRAAAELGFSKVEFLRDSKTKSSAFLYN
PEEFTVKNTEFINQIEDNVMAIVLLDKYIGNIDPLVRNFPDNLILQPILKEKLEDIKPF
IIKSYVYKMGNFIPECKPFILKKMEDKEKNLYIGIDLSHDTYARKTNLCIAAVDNTGDI
LYIGKHKNLELNEKMNLDILEKEYIKAFEKYIEKFNVSPENVFILRDGRFIEDIEIIKN
FISYNDTKYTLVEVNKNTNINSYDDLKEWIIKLDENTYIYYPKTFLNQKGVEVKILENN
TDYTIEEIIEQIYLLTRVAHSTPYTNYKLPYPLHIANKVALTDYEWKLYIPY