>5i75_B mol:protein length:221  8B6 antibody, heavy chain
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTS
YNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVS
SAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQ
SGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP