>5ig0_A mol:protein length:148  CAMK/CAMK2 protein kinase
GPHTVAEKQDTLVPAGPAKAVLEVNDELLKAVASGDWDAYTTMVDPNVTCFEPEAAGVL
AKGLAFHKFFFDNRSPNADKMKTTLHDPAVQMFGDTAIVTALRVVQFVADDGPKTTRYE
ETRVWVKDAAFKFGWKLVHFHRSGAHATPN