>5ih2_A mol:protein length:58  Adapter molecule crk
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR