>5ixg_A mol:protein length:169  YceI
SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHT
GSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSF
KCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ
>5ixg_C mol:protein length:169  YceI
SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHT
GSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSF
KCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ
>5ixg_D mol:protein length:169  YceI
SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHT
GSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSF
KCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ
>5ixg_D mol:protein length:169  YceI
SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHT
GSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSF
KCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ
>5ixg_B mol:protein length:169  YceI
SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHT
GSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSF
KCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ