>5iy8_1 mol:protein length:71  General transcription factor IIH subunit 5
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGE
LMDQNAFSLTQK