>5iy8_L mol:protein length:58  DNA-directed RNA polymerase II subunit RPB12
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR