>5iyb_I mol:protein length:125  DNA-directed RNA polymerase II subunit RPB9
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKIT
HEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPH
CGHRWTE