>5jkc_B mol:protein length:221  Sperm-egg fusion protein Juno
RSPWGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNF
SLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQ
EDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSN
SFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASEFLEVLFQ
>5jkc_B mol:protein length:221  Sperm-egg fusion protein Juno
RSPWGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNF
SLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQ
EDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSN
SFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASEFLEVLFQ
>5jkc_A mol:protein length:246  Izumo sperm-egg fusion protein 1
RSPWCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMG
VVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYC
PNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLT
DYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVL
PKEFLEVLFQ