>5jtm_C mol:protein length:155  Protein-export protein SecB
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVV
LRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMV
SRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA