>5jtp_A mol:protein length:155  Protein-export protein SecB
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVV
LRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMV
SRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA