>5k26_B mol:protein length:86  Mitogen-activated protein kinase kinase kinase 11,Chimera protein of MLK3-SH3 and MIP
HMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPS
NYVSRGGGAIRINPNGTWSRQAETVES