>5k79_B mol:protein length:108  Cyanovirin-N domain protein
TGQFSKTCEDITLDGSTLSAFCQKADGYTLNETSINLDEEIGNLDGTLSWGDHNFSLTC
DSIGLAQSLFTRTYVLAAECERRDGYTYIPTEIELDEHIANIDGTLTYE
>5k79_B mol:protein length:108  Cyanovirin-N domain protein
TGQFSKTCEDITLDGSTLSAFCQKADGYTLNETSINLDEEIGNLDGTLSWGDHNFSLTC
DSIGLAQSLFTRTYVLAAECERRDGYTYIPTEIELDEHIANIDGTLTYE
>5k79_A mol:protein length:108  Cyanovirin-N domain protein
TGQFSKTCEDITLDGSTLSAFCQKADGYTLNETSINLDEEIGNLDGTLSWGDHNFSLTC
DSIGLAQSLFTRTYVLAAECERRDGYTYIPTEIELDEHIANIDGTLTYE