>5ke6_C mol:na length:10  DNA (5'-D(*GP*CP*CP*AP*CP*AP*CP*CP*TP*C)-3')
GCCACACCTC
>5ke6_A mol:protein length:93  Krueppel-like factor 4
GPLGSRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTR
HYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
>5ke6_B mol:na length:10  DNA (5'-D(*GP*AP*GP*GP*TP*GP*TP*GP*GP*C)-3')
GAGGTGTGGC
>5ke6_C mol:na length:10  DNA (5'-D(*GP*CP*CP*AP*CP*AP*CP*CP*TP*C)-3')
GCCACACCTC