>5ke6_A mol:protein length:93  Krueppel-like factor 4
GPLGSRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTR
HYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF