>5kg5_P mol:na length:9  DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
AGCGTCATA
>5kg5_T mol:na length:12  DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
CATTATGACGCT
>5kg5_P mol:na length:9  DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
AGCGTCATA
>5kg5_A mol:protein length:435  DNA polymerase eta
GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARA
FGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASID
EAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQW
LDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPN
RQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGE
KNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEER
LTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSG
IQTEWSPPLTMLFLCATKFSAS