>5khr_B mol:protein length:84  Anaphase-promoting complex subunit 11
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHC
ILKWLHAQQVQQHCPMCRQEWKFKE