>5khr_W mol:protein length:85  Anaphase-promoting complex subunit CDC26
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQ
MINDRIGYKPQPKPNNRSSQFGSLEF