>5lks_Lb mol:protein length:157  Ribosomal protein L29, isoform CRA_a
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQA
NNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLGKRARARIAKGLRL
CRPKAKAKAKDQTKAQAAAPASVPAQAPKRTQAPTKASE