>5llu_A mol:protein length:522  Excitatory amino acid transporter 1,Neutral amino acid transporter B(0),Excitatory amino acid transporter 1
MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSFLRRNALLLLTVLAVI
LGVVLGFLLRPYPLSPREVKYFAFPGELLMRMLKMLILPLIVSSLITGLASLDAKASGR
LGMRAVVYYMSTTIIAVVLGIILVLIIHPGAASAAITASVGAAGSAENAPSKEVLDCFL
DLARNIFPSNLVSAAFRSYSTTYEERTITGTRVKVPVGQEVEGMNILGLVVFSIVFGIA
LGKMGEQGQLLVDFFNSLNEATMKLVAIIMWYAPLGILFLIAGKIVEMEDLEVLGGQLG
MYMVTVIVGLVIHGLIVLPLIYFLITRKNPFVFIAGILQALITALGTSSSSATLPITFK
CLEENNGVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITA
TAASIGAAGIPQAGLVTMVIVLTAVGLPTDDITLIIAVDWLLDRFRTMVNVLGDALGAG
IVEHLSRKELEKQDAELGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
>5llu_A mol:protein length:522  Excitatory amino acid transporter 1,Neutral amino acid transporter B(0),Excitatory amino acid transporter 1
MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSFLRRNALLLLTVLAVI
LGVVLGFLLRPYPLSPREVKYFAFPGELLMRMLKMLILPLIVSSLITGLASLDAKASGR
LGMRAVVYYMSTTIIAVVLGIILVLIIHPGAASAAITASVGAAGSAENAPSKEVLDCFL
DLARNIFPSNLVSAAFRSYSTTYEERTITGTRVKVPVGQEVEGMNILGLVVFSIVFGIA
LGKMGEQGQLLVDFFNSLNEATMKLVAIIMWYAPLGILFLIAGKIVEMEDLEVLGGQLG
MYMVTVIVGLVIHGLIVLPLIYFLITRKNPFVFIAGILQALITALGTSSSSATLPITFK
CLEENNGVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITA
TAASIGAAGIPQAGLVTMVIVLTAVGLPTDDITLIIAVDWLLDRFRTMVNVLGDALGAG
IVEHLSRKELEKQDAELGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM