>5lxr_A mol:protein length:90  RNA-binding protein 7
GPDSMGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFV
NFKHEVSVPYAMNLLNGIKLYGRPIKIQFRS