>5lxy_F mol:protein length:45  Zinc finger CCHC domain-containing protein 8
GPDSMRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLK