>5lxy_K mol:protein length:90  RNA-binding protein 7
GPDSMGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFV
NFKHEVSVPYAMNLLNGIKLYGRPIKIQFRS