>5lxy_L mol:protein length:45  Zinc finger CCHC domain-containing protein 8
GPDSMRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLK