>5lxy_M mol:protein length:90  RNA-binding protein 7
GPDSMGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFV
NFKHEVSVPYAMNLLNGIKLYGRPIKIQFRS