>5m64_D mol:protein length:137  DNA-directed RNA polymerase I subunit RPA14
MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTI
SGNAADADAAAVANTSLNIDTNLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKK
ETSIGVSATGGKKTTFADE