>5m64_I mol:protein length:125  DNA-directed RNA polymerase I subunit RPA12
MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSS
LRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCG
YKFRTNN