>5m72_A mol:protein length:160  Signal recognition particle subunit SRP72
GSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNV
INTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYD
ECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPGS
>5m72_B mol:protein length:71  Signal recognition particle subunit SRP68
MGSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPP
LEDKLEQKTKSG
>5m72_B mol:protein length:71  Signal recognition particle subunit SRP68
MGSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPP
LEDKLEQKTKSG