>5m72_A mol:protein length:160  Signal recognition particle subunit SRP72
GSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNV
INTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYD
ECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPGS