>5m73_G mol:protein length:203  Signal recognition particle subunit SRP68
MGHHHHHHLEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTG
KKVTEDLLTDNRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEEL
ERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEE
QAVLYNQRVEEISPNIRYCAYNIGDQ