>5mlu_G mol:protein length:105  Histone H2A type 1
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARD
NKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK