>5mr4_A mol:protein length:102  Neurturin
ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRL
RRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV