>5mr5_D mol:protein length:216  GDNF family receptor alpha-2
GTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALR
QFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLC
RSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWC
SCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVN